MRPS12 antibody (N-Term)

Catalog No. ABIN630980

Product Details anti-MRPS12 Antibody

Target: MRPS12 (Mitochondrial Ribosomal Protein S12 (MRPS12))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPS12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPS12 antibody was raised against the N terminal of MRPS12

Purification: Affinity purified

Immunogen: MRPS12 antibody was raised using the N terminal of MRPS12 corresponding to a region with amino acids LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPS12 Blocking Peptide, catalog no. 33R-5533, is also available for use as a blocking control in assays to test for specificity of this MRPS12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPS12

Target: MRPS12 (Mitochondrial Ribosomal Protein S12 (MRPS12))

Alternative Name: MRPS12 (MRPS12 Products)

Synonyms: MPR-S12 antibody, MT-RPS12 antibody, RPMS12 antibody, RPS12 antibody, RPSM12 antibody, AI327385 antibody, Rpms12 antibody, rps12 antibody, CG7925 antibody, Dmel\\CG7925 antibody, EG:BACH59J11.1 antibody, MRP-S12 antibody, MRPS12 antibody, S12 antibody, Tko antibody, l(1)3Ab antibody, l(1)tko antibody, mRpS12 antibody, mt-rps12 antibody, MGC64304 antibody, GB10531 antibody, mitochondrial ribosomal protein S12 antibody, technical knockout antibody, mitochondrial ribosomal protein S12 L homeolog antibody, 40S ribosomal protein S12, mitochondrial antibody, putative mitochondrial 37S ribosomal protein MRPS12 antibody, fragile site, aphidicolin type, common, fra(6)(p22.2) antibody, MRPS12 antibody, Mrps12 antibody, tko antibody, mrps12.L antibody, LOC409723 antibody, mRpS12 antibody, mrps12 antibody, CAALFM_C106070WA antibody, mrpS12 antibody, FRA6C antibody

Background: Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS12 is the 28S subunit protein that belongs to the ribosomal protein S12P family. The protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.

Molecular Weight: 12 kDa (MW of target protein)

Pathways: Sensory Perception of Sound