MRPL28 antibody (Middle Region)

Catalog No. ABIN630991

Product Details anti-MRPL28 Antibody

Target: MRPL28 (Mitochondrial Ribosomal Protein L28 (MRPL28))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL28 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPL28 antibody was raised against the middle region of MRPL28

Purification: Affinity purified

Immunogen: MRPL28 antibody was raised using the middle region of MRPL28 corresponding to a region with amino acids EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL28 Blocking Peptide, catalog no. 33R-2324, is also available for use as a blocking control in assays to test for specificity of this MRPL28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL28

Target: MRPL28 (Mitochondrial Ribosomal Protein L28 (MRPL28))

Alternative Name: MRPL28 (MRPL28 Products)

Synonyms: MAAT1 antibody, p15 antibody, CG3782 antibody, Dmel\\CG3782 antibody, MRP-L28 antibody, 1110015G04Rik antibody, L28mt antibody, GB14554 antibody, MRPL28 antibody, maat1 antibody, wu:fa96b11 antibody, zgc:110013 antibody, mitochondrial ribosomal protein L28 antibody, 39S ribosomal protein L28, mitochondrial antibody, mitochondrial ribosomal protein L28 L homeolog antibody, mitochondrial 54S ribosomal protein YmL28 antibody, mitochondrial ribosomal protein subunit L28 (predicted) antibody, Putative mitochondrial ribosomal protein L28 antibody, MRPL28 antibody, mRpL28 antibody, Mrpl28 antibody, LOC412473 antibody, mrpl28.L antibody, mrpl28 antibody, CAALFM_C108520CA antibody

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases