MRPL37 antibody (N-Term)

Catalog No. ABIN630997

Product Details anti-MRPL37 Antibody

Target: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL37 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPL37 antibody was raised against the N terminal of MRPL37

Purification: Affinity purified

Immunogen: MRPL37 antibody was raised using the N terminal of MRPL37 corresponding to a region with amino acids VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL37 Blocking Peptide, catalog no. 33R-9789, is also available for use as a blocking control in assays to test for specificity of this MRPL37 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL37 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL37

Target: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Alternative Name: MRPL37 (MRPL37 Products)

Synonyms: L37mt antibody, MRP-L2 antibody, MRP-L37 antibody, MRPL2 antibody, RPML2 antibody, 2300004O14Rik antibody, AI132596 antibody, Rpml2 antibody, mitochondrial ribosomal protein L37 antibody, MRPL37 antibody, Mrpl37 antibody

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Molecular Weight: 48 kDa (MW of target protein)