LACTB antibody (C-Term)

Catalog No. ABIN631015

Product Details anti-LACTB Antibody

Target: LACTB (Lactamase, beta (LACTB))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LACTB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Beta Lactamase antibody was raised against the C terminal of LACTB

Purification: Affinity purified

Immunogen: Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Lactamase Blocking Peptide, catalog no. 33R-9050, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LACTB

Target: LACTB (Lactamase, beta (LACTB))

Alternative Name: beta Lactamase (LACTB Products)

Synonyms: BA2507 antibody, PSPTO2834 antibody, PSPTO3594 antibody, G24 antibody, MRPL56 antibody, LACT-1 antibody, Lact1 antibody, Mrpl56 antibody, zgc:110419 antibody, beta-lactamase antibody, class C beta-lactamase AmpC antibody, metal-dependent hydrolase antibody, lactamase beta antibody, Beta-lactamase antibody, lactamase, beta antibody, metallo-beta-lactamase domain containing 2 antibody, Beta lactamase antibody, bla1 antibody, ampC antibody, PSPTO_2834 antibody, GSU1378 antibody, MCA2220 antibody, CJE0344 antibody, LACTB antibody, Rmar_1357 antibody, MGYG_07395 antibody, ML5_3452 antibody, bla antibody, Lactb antibody, lactb antibody, MBLAC2 antibody, blaKPC-2 antibody

Background: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Molecular Weight: 61 kDa (MW of target protein)