PPM1K antibody

Catalog No. ABIN631029

Product Details anti-PPM1K Antibody

Target: PPM1K (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPM1K antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PPM1 K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPM1K Blocking Peptide, catalog no. 33R-1241, is also available for use as a blocking control in assays to test for specificity of this PPM1K antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPM1K

Target: PPM1K (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1K (PPM1K))

Alternative Name: PPM1K (PPM1K Products)

Synonyms: 2900063A19Rik antibody, A930026L03Rik antibody, PP2Cm antibody, im:6912645 antibody, zgc:113207 antibody, BDP antibody, MSUDMV antibody, PP2Ckappa antibody, PTMP antibody, UG0882E07 antibody, RGD1308501 antibody, protein phosphatase 1K (PP2C domain containing) antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1K antibody, protein phosphatase, Mg2+/Mn2+ dependent 1K antibody, protein phosphatase, Mg2+/Mn2+ dependent 1K S homeolog antibody, Ppm1k antibody, ppm1k antibody, PPM1K antibody, ppm1k.S antibody

Background: PPM1K regulates the mitochondrial permeability transition pore and is essential for cellular survival and development.

Molecular Weight: 41 kDa (MW of target protein)