Acetyl-CoA Acetyltransferase 1 (ACAT1) antibody

Antigen: Acetyl-CoA Acetyltransferase 1 (ACAT1)

Synonyms: T2, MAT, ACAT, THIL, SOAT, STAT, ACACT, ACAT1, RP11-215I23.2, ald, Acact, ACAT-1, AW550831, 8430426K15Rik, RATACAL, Acat-1, Acat, 6330585C21Rik, fd16h07, fd20g06, zgc:86832, wu:fd16h07, wu:fd20g06, MGC137917, MGC107795, acat1, CEH, TGH, CES2, HMSE, SES1, HMSE1, PCE-1, MGC117365, Es2, MGC109055, LOC100009551

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN631042

Additional Information

Alternative name: ACAT1

Immunogen: ACAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

Description: ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.

Molecular Weight: 41 kDa (MW of target protein)

Synonyms: T2, MAT, ACAT, THIL, SOAT, STAT, ACACT, ACAT1, RP11-215I23.2, ald, Acact, ACAT-1, AW550831, 8430426K15Rik, RATACAL, Acat-1, Acat, 6330585C21Rik, fd16h07, fd20g06, zgc:86832, wu:fd16h07, wu:fd20g06, MGC137917, MGC107795, acat1, CEH, TGH, CES2, HMSE, SES1, HMSE1, PCE-1, MGC117365, Es2, MGC109055, LOC100009551

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACAT1 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Cancer, Metabolism, Organelles

Restrictions: For Research Use only