ISCA2 antibody

Catalog No. ABIN631044

Product Details anti-ISCA2 Antibody

Target: ISCA2 (Iron-Sulfur Cluster Assembly 2 Homolog (ISCA2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ISCA2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ISCA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ISCA2 Blocking Peptide, catalog no. 33R-8133, is also available for use as a blocking control in assays to test for specificity of this ISCA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISCA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ISCA2

Target: ISCA2 (Iron-Sulfur Cluster Assembly 2 Homolog (ISCA2))

Alternative Name: ISCA2 (ISCA2 Products)

Synonyms: HBLD1 antibody, ISA2 antibody, c14_5557 antibody, Hbld1 antibody, RGD1563216 antibody, 0710001C05Rik antibody, 5730594E03Rik antibody, iron-sulfur cluster assembly 2 antibody, ISCA2 antibody, Isca2 antibody

Background: ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.

Molecular Weight: 16 kDa (MW of target protein)