INPP5B antibody (Middle Region)

Catalog No. ABIN631045

Product Details anti-INPP5B Antibody

Target: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INPP5B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: INPP5 B antibody was raised against the middle region of INPP5

Purification: Affinity purified

Immunogen: INPP5 B antibody was raised using the middle region of INPP5 corresponding to a region with amino acids IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INPP5B Blocking Peptide, catalog no. 33R-3984, is also available for use as a blocking control in assays to test for specificity of this INPP5B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INPP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INPP5B

Target: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Alternative Name: INPP5B (INPP5B Products)

Synonyms: 75kDa antibody, AW260155 antibody, INPP5P antibody, 5PTase antibody, inositol polyphosphate-5-phosphatase B antibody, type II inositol 1,4,5-trisphosphate 5-phosphatase-like antibody, inositol polyphosphate-5-phosphatase B L homeolog antibody, inositol polyphosphate 5-phosphatase OCRL-1 antibody, INPP5B antibody, LOC100224437 antibody, inpp5b.L antibody, LOC100159919 antibody, Inpp5b antibody

Background: Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B is the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus.

Molecular Weight: 77 kDa (MW of target protein)