ME3 antibody
-
- Target See all ME3 Antibodies
- ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ME3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD
- Top Product
- Discover our top product ME3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ME3 Blocking Peptide, catalog no. 33R-7120, is also available for use as a blocking control in assays to test for specificity of this ME3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ME3 (Malic Enzyme 3, NADP(+)-Dependent, Mitochondrial (ME3))
- Alternative Name
- ME3 (ME3 Products)
- Synonyms
- NADP-ME antibody, 1700020C08Rik antibody, B230207H15Rik antibody, im:7151680 antibody, wu:fi43b04 antibody, zgc:163117 antibody, malic enzyme 3 antibody, malic enzyme 3, NADP(+)-dependent, mitochondrial antibody, malic enzyme 3, NADP(+)-dependent, mitochondrial L homeolog antibody, NADP malic enzyme 3 antibody, ME3 antibody, Me3 antibody, me3 antibody, me3.L antibody
- Background
- Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. ME3 is a mitochondrial NADP(+)-dependent isoform.
- Molecular Weight
- 67 kDa (MW of target protein)
- Pathways
- Warburg Effect
-