DLAT antibody (C-Term)

Catalog No. ABIN631076

Product Details anti-DLAT Antibody

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLAT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DLAT antibody was raised against the C terminal of DLAT

Purification: Affinity purified

Immunogen: DLAT antibody was raised using the C terminal of DLAT corresponding to a region with amino acids DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLAT Blocking Peptide, catalog no. 33R-2227, is also available for use as a blocking control in assays to test for specificity of this DLAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLAT

Target: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Alternative Name: DLAT (DLAT Products)

Synonyms: DLAT antibody, Dmel\\CG5261 antibody, EP(2)0816 antibody, EP816 antibody, anon-WO0118547.121 antibody, DLTA antibody, PDC-E2 antibody, PDCE2 antibody, wu:fc14f10 antibody, wu:fc21f08 antibody, wu:fc86g11 antibody, wu:fj57d06 antibody, 6332404G05Rik antibody, midline uncoordinated antibody, dihydrolipoamide S-acetyltransferase L homeolog antibody, dihydrolipoamide S-acetyltransferase antibody, dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) antibody, muc antibody, dlat.L antibody, DLAT antibody, Dlat antibody, dlat antibody

Background: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Molecular Weight: 69 kDa (MW of target protein)