NAD-ME antibody

Catalog No. ABIN631085

Product Details anti-NAD-ME Antibody

Target: NAD-ME (NAD Dependent Malate Dehydrogenase (NAD-ME))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAD-ME antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ME2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ME2 Blocking Peptide, catalog no. 33R-5654, is also available for use as a blocking control in assays to test for specificity of this ME2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAD-ME

Target: NAD-ME (NAD Dependent Malate Dehydrogenase (NAD-ME))

Alternative Name: ME2 (NAD-ME Products)

Synonyms: ODS1 antibody, AW120568 antibody, D030040L20Rik antibody, NAD-ME antibody, zgc:100941 antibody, malic enzyme 2 antibody, malic enzyme 2, NAD(+)-dependent, mitochondrial antibody, malic enzyme 2, NAD(+)-dependent, mitochondrial S homeolog antibody, ME2 antibody, Me2 antibody, me2.S antibody, me2 antibody

Background: ME2 is a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response