ZCCHC12 antibody (N-Term)

Catalog No. ABIN631133

Product Details anti-ZCCHC12 Antibody

Target: ZCCHC12 (Zinc Finger, CCHC Domain Containing 12 (ZCCHC12))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZCCHC12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZCCHC12 antibody was raised against the N terminal of ZCCHC12

Purification: Affinity purified

Immunogen: ZCCHC12 antibody was raised using the N terminal of ZCCHC12 corresponding to a region with amino acids AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZCCHC12 Blocking Peptide, catalog no. 33R-1469, is also available for use as a blocking control in assays to test for specificity of this ZCCHC12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZCCHC12

Target: ZCCHC12 (Zinc Finger, CCHC Domain Containing 12 (ZCCHC12))

Alternative Name: ZCCHC12 (ZCCHC12 Products)

Synonyms: PNMA7A antibody, SIZN antibody, SIZN1 antibody, 2810028A01Rik antibody, AV136720 antibody, Sizn1 antibody, zinc finger CCHC-type containing 12 antibody, sterile alpha motif domain containing 12 antibody, zinc finger, CCHC domain containing 12 antibody, ZCCHC12 antibody, samd12 antibody, Zcchc12 antibody

Background: ZCCHC12 contains 1 CCHC-type zinc finger. ZCCHC12 is the transcriptional coactivator in the bone morphogenetic protein (BMP)-signaling pathway. It positively modulates BMP signaling by interacting with SMAD1 and associating with CBP in the transcription complex. It contributes to the BMP-induced enhancement of cholinergic-neuron-specific gene expression.

Molecular Weight: 45 kDa (MW of target protein)