PCDH17 antibody (C-Term)

Catalog No. ABIN631153

Product Details anti-PCDH17 Antibody

Target: PCDH17 (Protocadherin 17 (PCDH17))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDH17 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCDH17 antibody was raised against the C terminal of PCDH17

Purification: Affinity purified

Immunogen: PCDH17 antibody was raised using the C terminal of PCDH17 corresponding to a region with amino acids SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDH17 Blocking Peptide, catalog no. 33R-8394, is also available for use as a blocking control in assays to test for specificity of this PCDH17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDH17

Target: PCDH17 (Protocadherin 17 (PCDH17))

Alternative Name: PCDH17 (PCDH17 Products)

Synonyms: PCDH68 antibody, PCH68 antibody, C030033F14Rik antibody, Gm78 antibody, protocadherin 17 antibody, PCDH17 antibody, Pcdh17 antibody

Background: PCDH17 contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins.It may play a role in the establishment and function of specific cell-cell connections in the brain.

Molecular Weight: 124 kDa (MW of target protein)