MTPN antibody (Middle Region)

Catalog No. ABIN631163

Product Details anti-MTPN Antibody

Target: MTPN (Myotrophin (MTPN))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTPN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Myotrophin antibody was raised against the middle region of MTPN

Purification: Affinity purified

Immunogen: Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Myotrophin Blocking Peptide, catalog no. 33R-3534, is also available for use as a blocking control in assays to test for specificity of this Myotrophin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTPN

Target: MTPN (Myotrophin (MTPN))

Alternative Name: Myotrophin (MTPN Products)

Synonyms: MGC76285 antibody, GCDP antibody, V-1 antibody, Gcdp antibody, wu:fa10f07 antibody, zgc:64078 antibody, 5033418D15Rik antibody, V1 antibody, myotrophin antibody, myotrophin S homeolog antibody, mtpn antibody, MTPN antibody, Mtpn antibody, mtpn.S antibody

Background: MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.

Molecular Weight: 13 kDa (MW of target protein)