OPTN antibody (C-Term)

Catalog No. ABIN631194

Product Details anti-OPTN Antibody

Target: OPTN (Optineurin (OPTN))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OPTN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Optineurin antibody was raised against the C terminal of OPTN

Purification: Affinity purified

Immunogen: Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Optineurin Blocking Peptide, catalog no. 33R-8367, is also available for use as a blocking control in assays to test for specificity of this Optineurin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OPTN

Target: OPTN (Optineurin (OPTN))

Alternative Name: Optineurin (OPTN Products)

Synonyms: nrp antibody, fip2 antibody, hip7 antibody, hypl antibody, glc1e antibody, tfiiia-intp antibody, ALS12 antibody, FIP2 antibody, GLC1E antibody, HIP7 antibody, HYPL antibody, NRP antibody, TFIIIA-INTP antibody, Fip2 antibody, 4930441O07Rik antibody, fj52f04 antibody, si:ch211-240l19.3 antibody, wu:fj52f04 antibody, zgc:66386 antibody, zgc:77868 antibody, optineurin antibody, optineurin L homeolog antibody, OPTN antibody, optn antibody, Optn antibody, optn.L antibody

Background: OPTN is the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: M Phase