IFT122 antibody

Catalog No. ABIN631200

Product Details anti-IFT122 Antibody

Target: IFT122 (Intraflagellar Transport 122 (IFT122))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFT122 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: IFT122 antibody was raised using a synthetic peptide corresponding to a region with amino acids QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFT122 Blocking Peptide, catalog no. 33R-7457, is also available for use as a blocking control in assays to test for specificity of this IFT122 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT122 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFT122

Target: IFT122 (Intraflagellar Transport 122 (IFT122))

Alternative Name: IFT122 (IFT122 Products)

Synonyms: C86139 antibody, Wdr10 antibody, sopb antibody, CED antibody, CED1 antibody, SPG antibody, WDR10 antibody, WDR10p antibody, WDR140 antibody, intraflagellar transport 122 antibody, intraflagellar transport protein 122 homolog antibody, IFT122 antibody, ift122 antibody, LOC100639275 antibody, LOC100649523 antibody, Ift122 antibody

Background: IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.

Molecular Weight: 129 kDa (MW of target protein)

Pathways: Tube Formation, Embryonic Body Morphogenesis