PPL antibody (Middle Region)

Catalog No. ABIN631225

Product Details anti-PPL Antibody

Target: PPL (Periplakin (PPL))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Periplakin antibody was raised against the middle region of PPL

Purification: Affinity purified

Immunogen: Periplakin antibody was raised using the middle region of PPL corresponding to a region with amino acids EKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Periplakin Blocking Peptide, catalog no. 33R-2523, is also available for use as a blocking control in assays to test for specificity of this Periplakin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPL

Target: PPL (Periplakin (PPL))

Alternative Name: Periplakin (PPL Products)

Synonyms: cb180 antibody, sb:cb180 antibody, im:7140067 antibody, im:7149519 antibody, AW553870 antibody, periplakin antibody, periplakin L homeolog antibody, PPL antibody, ppl antibody, ppl.L antibody, Ppl antibody

Background: PPL is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

Molecular Weight: 205 kDa (MW of target protein)