RAP1B antibody (N-Term)

Catalog No. ABIN631250

Product Details anti-RAP1B Antibody

Target: RAP1B (RAP1B, Member of RAS Oncogene Family (RAP1B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAP1B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAP1 B antibody was raised against the N terminal of RAP1

Purification: Affinity purified

Immunogen: RAP1 B antibody was raised using the N terminal of RAP1 corresponding to a region with amino acids MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAP1B Blocking Peptide, catalog no. 33R-6359, is also available for use as a blocking control in assays to test for specificity of this RAP1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAP1B

Target: RAP1B (RAP1B, Member of RAS Oncogene Family (RAP1B))

Alternative Name: RAP1B (RAP1B Products)

Synonyms: K-REV antibody, RAL1B antibody, k-rev antibody, ral1b antibody, 2810443E11Rik antibody, Rap1b antibody, cb1026 antibody, cb119 antibody, sb:cb119 antibody, wu:fb11c04 antibody, wu:fb74e09 antibody, wu:fk70e05 antibody, RAP1B, member of RAS oncogene family antibody, RAP1B, member of RAS oncogene family L homeolog antibody, RAS related protein 1b antibody, ras-related protein Rap-1b-like antibody, RAP1B antibody, Rap1b antibody, rap1b.L antibody, Bm1_39445 antibody, LOC109067672 antibody, rap1b antibody

Background: RAP1B and RAP1A belong to a superfamily of RAS-like small GTP-binding proteins involved in cell signaling.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: CXCR4-mediated Signaling Events, Signaling of Hepatocyte Growth Factor Receptor