EHD4 antibody (Middle Region)
-
- Target See all EHD4 Antibodies
- EHD4 (EH-Domain Containing 4 (EHD4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EHD4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EHD4 antibody was raised against the middle region of EHD4
- Purification
- Affinity purified
- Immunogen
- EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT
- Top Product
- Discover our top product EHD4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EHD4 Blocking Peptide, catalog no. 33R-4251, is also available for use as a blocking control in assays to test for specificity of this EHD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EHD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EHD4 (EH-Domain Containing 4 (EHD4))
- Alternative Name
- EHD4 (EHD4 Products)
- Synonyms
- EHD4 antibody, past4 antibody, PAST4 antibody, 2210022F10Rik antibody, AI197390 antibody, AI846352 antibody, AV006278 antibody, Past2 antibody, EH domain containing 4 antibody, EH-domain containing 4 antibody, EH domain containing 4 L homeolog antibody, EHD4 antibody, ehd4 antibody, ehd4.L antibody, Ehd4 antibody
- Background
- EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.
- Molecular Weight
- 61 kDa (MW of target protein)
-