EHD4 antibody (Middle Region)

Catalog No. ABIN631253

Product Details anti-EHD4 Antibody

Target: EHD4 (EH-Domain Containing 4 (EHD4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EHD4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EHD4 antibody was raised against the middle region of EHD4

Purification: Affinity purified

Immunogen: EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EHD4 Blocking Peptide, catalog no. 33R-4251, is also available for use as a blocking control in assays to test for specificity of this EHD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EHD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EHD4

Target: EHD4 (EH-Domain Containing 4 (EHD4))

Alternative Name: EHD4 (EHD4 Products)

Synonyms: EHD4 antibody, past4 antibody, PAST4 antibody, 2210022F10Rik antibody, AI197390 antibody, AI846352 antibody, AV006278 antibody, Past2 antibody, EH domain containing 4 antibody, EH-domain containing 4 antibody, EH domain containing 4 L homeolog antibody, EHD4 antibody, ehd4 antibody, ehd4.L antibody, Ehd4 antibody

Background: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Molecular Weight: 61 kDa (MW of target protein)