PRKRIP1 antibody

Catalog No. ABIN631288

Product Details anti-PRKRIP1 Antibody

Target: PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKRIP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PRKRIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKRIP1 Blocking Peptide, catalog no. 33R-5756, is also available for use as a blocking control in assays to test for specificity of this PRKRIP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKRIP1

Target: PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))

Alternative Name: PRKRIP1 (PRKRIP1 Products)

Synonyms: C114 antibody, KRBOX3 antibody, 8430424D23Rik antibody, PRKR interacting protein 1 antibody, Prkr interacting protein 1 (IL11 inducible) antibody, PRKR interacting protein 1 (IL11 inducible) antibody, PRKR interacting protein 1) L homeolog antibody, PRKRIP1 antibody, Prkrip1 antibody, prkrip1 antibody, prkrip1.L antibody

Background: PRKRIP1 binds double-stranded RNA. It inhibits EIF2AK2 kinase activity.

Molecular Weight: 21 kDa (MW of target protein)