FIL1L antibody (Middle Region)

Catalog No. ABIN631303

Product Details anti-FIL1L Antibody

Target: FIL1L (FILIP1L) (Filamin A Interacting Protein 1-Like (FILIP1L))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FIL1L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FILIP1 L antibody was raised against the middle region of FILIP1

Purification: Affinity purified

Immunogen: FILIP1 L antibody was raised using the middle region of FILIP1 corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FILIP1L Blocking Peptide, catalog no. 33R-4655, is also available for use as a blocking control in assays to test for specificity of this FILIP1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FILIP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FIL1L

Target: FIL1L (FILIP1L) (Filamin A Interacting Protein 1-Like (FILIP1L))

Alternative Name: FILIP1L (FILIP1L Products)

Synonyms: DOC-1 antibody, DOC1 antibody, GIP130 antibody, GIP130a antibody, GIP130b antibody, GIP130c antibody, GIP90 antibody, 4631422O05Rik antibody, Doc1 antibody, FILIP1L antibody, filamin A interacting protein 1 like antibody, filamin A interacting protein 1-like antibody, FILIP1L antibody, Filip1l antibody, filip1l antibody

Background: FILIP1L acts as a regulator of the antiangiogenic activity on endothelial cells. When overexpressed in endothelial cells, FILIP1L leads to inhibition of cell proliferation and migration and an increase in apoptosis.

Molecular Weight: 102 kDa (MW of target protein)