MYLIP antibody (Middle Region)

Catalog No. ABIN631309

Product Details anti-MYLIP Antibody

Target: MYLIP (Myosin Regulatory Light Chain Interacting Protein (MYLIP))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYLIP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MYLIP antibody was raised against the middle region of MYLIP

Purification: Affinity purified

Immunogen: MYLIP antibody was raised using the middle region of MYLIP corresponding to a region with amino acids CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYLIP Blocking Peptide, catalog no. 33R-1817, is also available for use as a blocking control in assays to test for specificity of this MYLIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYLIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYLIP

Target: MYLIP (Myosin Regulatory Light Chain Interacting Protein (MYLIP))

Alternative Name: MYLIP (MYLIP Products)

Synonyms: IDOL antibody, MIR antibody, 9430057C20Rik antibody, Mir antibody, mylip antibody, wu:fj36b03 antibody, zgc:55987 antibody, MYLIP antibody, mir antibody, zgc:153767 antibody, myosin regulatory light chain interacting protein antibody, myosin regulatory light chain interacting protein a antibody, myosin regulatory light chain interacting protein L homeolog antibody, myosin regulatory light chain interacting protein b antibody, MYLIP antibody, Mylip antibody, mylipa antibody, mylip.L antibody, mylip antibody, mylipb antibody

Background: The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.

Molecular Weight: 50 kDa (MW of target protein)