LIPT1 antibody (N-Term)

Catalog No. ABIN631332

Product Details anti-LIPT1 Antibody

Target: LIPT1 (Lipoyltransferase 1 (LIPT1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIPT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LIPT1 antibody was raised against the N terminal of LIPT1

Purification: Affinity purified

Immunogen: LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LIPT1 Blocking Peptide, catalog no. 33R-6654, is also available for use as a blocking control in assays to test for specificity of this LIPT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LIPT1

Target: LIPT1 (Lipoyltransferase 1 (LIPT1))

Alternative Name: LIPT1 (LIPT1 Products)

Synonyms: EG623661 antibody, lipoyltransferase 1 antibody, chromosome 10 C2orf15 homolog antibody, LIPT1 antibody, MCYG_01144 antibody, MGYG_01698 antibody, C10H2orf15 antibody, Lipt1 antibody

Background: The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, LIPT1 transfers the lipoyl moiety to apoproteins.

Molecular Weight: 42 kDa (MW of target protein)