HACE1 antibody (Middle Region)
-
- Target See all HACE1 Antibodies
- HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HACE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HACE1 antibody was raised against the middle region of HACE1
- Purification
- Affinity purified
- Immunogen
- HACE1 antibody was raised using the middle region of HACE1 corresponding to a region with amino acids DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV
- Top Product
- Discover our top product HACE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HACE1 Blocking Peptide, catalog no. 33R-2223, is also available for use as a blocking control in assays to test for specificity of this HACE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HACE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))
- Alternative Name
- HACE1 (HACE1 Products)
- Synonyms
- HACE1 antibody, 1700042J16Rik antibody, A730034A22Rik antibody, BC025474 antibody, HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 antibody, HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 L homeolog antibody, HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1 antibody, HACE1 antibody, hace1 antibody, hace1.L antibody, Hace1 antibody
- Background
- HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.
- Molecular Weight
- 102 kDa (MW of target protein)
-