RNF212 antibody (Middle Region)

Catalog No. ABIN631396

Product Details anti-RNF212 Antibody

Target: RNF212 (Ring Finger Protein 212 (RNF212))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF212 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF212 antibody was raised against the middle region of RNF212

Purification: Affinity purified

Immunogen: RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF212 Blocking Peptide, catalog no. 33R-4823, is also available for use as a blocking control in assays to test for specificity of this RNF212 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF212 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF212

Target: RNF212 (Ring Finger Protein 212 (RNF212))

Alternative Name: RNF212 (RNF212 Products)

Synonyms: ZHP3 antibody, ring finger protein 212 antibody, RNF212 antibody

Background: RNF212 contains 1 RING-type zinc finger. The function of the RNF212 protein remains unknown.

Molecular Weight: 26 kDa (MW of target protein)