LDLRAP1 antibody (N-Term)

Catalog No. ABIN631410

Product Details anti-LDLRAP1 Antibody

Target: LDLRAP1 (Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LDLRAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LDLRAP1 antibody was raised against the N terminal of LDLRAP1

Purification: Affinity purified

Immunogen: LDLRAP1 antibody was raised using the N terminal of LDLRAP1 corresponding to a region with amino acids WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LDLRAP1 Blocking Peptide, catalog no. 33R-10023, is also available for use as a blocking control in assays to test for specificity of this LDLRAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDLRAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-LDLRAP1 antibody (ABIN631410)

Holla, Strøm, Cameron, Berge, Leren: "A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." in: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).

Target Details for LDLRAP1

Target: LDLRAP1 (Low Density Lipoprotein Receptor Adaptor Protein 1 (LDLRAP1))

Alternative Name: LDLRAP1 (LDLRAP1 Products)

Synonyms: ARH antibody, ARH1 antibody, ARH2 antibody, FHCB1 antibody, FHCB2 antibody, AA691260 antibody, Arh antibody, Arh1 antibody, RGD1563417 antibody, arh antibody, arh1 antibody, arh2 antibody, fhcb1 antibody, fhcb2 antibody, xptb antibody, LDLRAP1 antibody, ldlrap1 antibody, sb:cb50 antibody, zgc:56121 antibody, zgc:158745 antibody, low density lipoprotein receptor adaptor protein 1 antibody, low density lipoprotein receptor adaptor protein 1 L homeolog antibody, low density lipoprotein receptor adaptor protein 1 S homeolog antibody, low density lipoprotein receptor adaptor protein 1a antibody, low density lipoprotein receptor adaptor protein 1b antibody, LDLRAP1 antibody, Ldlrap1 antibody, ldlrap1 antibody, ldlrap1.L antibody, ldlrap1.S antibody, ldlrap1a antibody, ldlrap1b antibody

Background: LDLRAP1 is an adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). LDLRAP1 may be required for LDL binding and internalization but not for receptor clustering in coated pits. LDLRAP1 may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Lipid Metabolism