EPB41 antibody (N-Term)

Catalog No. ABIN631411

Product Details anti-EPB41 Antibody

Target: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPB41 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EPB41 antibody was raised against the N terminal of EPB41

Purification: Affinity purified

Immunogen: EPB41 antibody was raised using the N terminal of EPB41 corresponding to a region with amino acids SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EPB41 Blocking Peptide, catalog no. 33R-8404, is also available for use as a blocking control in assays to test for specificity of this EPB41 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB41 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EPB41

Target: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Alternative Name: EPB41 (EPB41 Products)

Synonyms: P4.1R antibody, epb41 antibody, wu:fb70c02 antibody, EPB41 antibody, el1 antibody, 4.1r antibody, 4.1R antibody, EL1 antibody, HE antibody, AI415518 antibody, D4Ertd442e antibody, Elp-1 antibody, Elp1 antibody, Epb41 antibody, mKIAA4056 antibody, erythrocyte membrane protein band 4.1b antibody, erythrocyte membrane protein band 4.1 antibody, erythrocyte membrane protein band 4.1 L homeolog antibody, epb41b antibody, EPB41 antibody, epb41 antibody, epb41.L antibody, Epb41 antibody

Background: Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene, the beta-spectrin gene, or the band 3 gene.

Molecular Weight: 85 kDa (MW of target protein)