PDS5B antibody

Catalog No. ABIN631437

Product Details anti-PDS5B Antibody

Target: PDS5B (PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDS5B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PDS5 B antibody was raised using a synthetic peptide corresponding to a region with amino acids DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDS5B Blocking Peptide, catalog no. 33R-1917, is also available for use as a blocking control in assays to test for specificity of this PDS5B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDS5B

Target: PDS5B (PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B))

Alternative Name: PDS5B (PDS5B Products)

Synonyms: APRIN antibody, AS3 antibody, CG008 antibody, Aprin antibody, as3 antibody, aprin antibody, AI646570 antibody, AW212954 antibody, mKIAA0979 antibody, pds5b antibody, PDS5 cohesin associated factor B antibody, PDS5 cohesin associated factor B L homeolog antibody, PDS5B antibody, Pds5b antibody, pds5b antibody, pds5b.L antibody

Background: PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.

Molecular Weight: 159 kDa (MW of target protein)