Glycogen Synthase 2 antibody

Catalog No. ABIN631445

Product Details anti-Glycogen Synthase 2 Antibody

Target: Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glycogen Synthase 2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Glycogen Synthase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Glycogen Synthase 2 Blocking Peptide, catalog no. 33R-9185, is also available for use as a blocking control in assays to test for specificity of this Glycogen Synthase 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GYS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glycogen Synthase 2

Target: Glycogen Synthase 2 (GYS2) (Glycogen Synthase 2, Liver (GYS2))

Alternative Name: Glycogen Synthase 2 (GYS2 Products)

Synonyms: cb765 antibody, zgc:112057 antibody, BC021322 antibody, LGS antibody, GLYSN antibody, glycogen synthase 2 antibody, gys2 antibody, Gys2 antibody, GYS2 antibody

Background: GYS2 transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.

Molecular Weight: 81 kDa (MW of target protein)

Pathways: AMPK Signaling, Cellular Glucan Metabolic Process