CDCA5 antibody (Middle Region)
-
- Target See all CDCA5 Antibodies
- CDCA5 (Cell Division Cycle Associated 5 (CDCA5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDCA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CDCA5 antibody was raised against the middle region of CDCA5
- Purification
- Affinity purified
- Immunogen
- CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST
- Top Product
- Discover our top product CDCA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDCA5 Blocking Peptide, catalog no. 33R-1570, is also available for use as a blocking control in assays to test for specificity of this CDCA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDCA5 (Cell Division Cycle Associated 5 (CDCA5))
- Alternative Name
- CDCA5 (CDCA5 Products)
- Synonyms
- SORORIN antibody, 2610036L13Rik antibody, AL024086 antibody, AW536684 antibody, C85404 antibody, CDCA5 antibody, RGD1560863 antibody, sororin antibody, cdca5 antibody, cell division cycle associated 5 antibody, cell division cycle associated 5 S homeolog antibody, CDCA5 antibody, Cdca5 antibody, cdca5 antibody, cdca5.S antibody
- Background
- CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-