MYH10 antibody (N-Term)

Catalog No. ABIN631458

Product Details anti-MYH10 Antibody

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYH10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MYH10 antibody was raised against the N terminal of MYH10

Purification: Affinity purified

Immunogen: MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYH10 Blocking Peptide, catalog no. 33R-9945, is also available for use as a blocking control in assays to test for specificity of this MYH10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYH10

Target: MYH10 (Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10))

Alternative Name: MYH10 (MYH10 Products)

Synonyms: 5730504C04Rik antibody, 9330167F11Rik antibody, Fltn antibody, Myhn-2 antibody, Myhn2 antibody, NMHC II-B antibody, NMHC-B antibody, NMHCII-B antibody, NMMHC II-b antibody, NMMHC-B antibody, NMMHC-IIB antibody, SMemb antibody, mKIAA3005 antibody, MCH-B antibody, nmmhcb antibody, myosin antibody, myosin-10 antibody, non-muscle antibody, NMMHCB antibody, dZ204D19.2 antibody, si:dz150i12.3 antibody, wu:fc46h07 antibody, wu:fy19d11 antibody, myosin, heavy polypeptide 10, non-muscle antibody, myosin heavy chain 10 antibody, myosin, heavy chain 10, non-muscle S homeolog antibody, myosin, heavy chain 10, non-muscle antibody, Myh10 antibody, myh10.S antibody, MYH10 antibody, myh10 antibody

Background: MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.

Molecular Weight: 229 kDa (MW of target protein)