OSBPL9 antibody (N-Term)

Catalog No. ABIN631464

Product Details anti-OSBPL9 Antibody

Target: OSBPL9 (Oxysterol Binding Protein-Like 9 (OSBPL9))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OSBPL9 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificity: OSBPL9 antibody was raised against the N terminal of OSBPL9

Purification: Affinity purified

Immunogen: OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OSBPL9 Blocking Peptide, catalog no. 33R-3831, is also available for use as a blocking control in assays to test for specificity of this OSBPL9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OSBPL9

Target: OSBPL9 (Oxysterol Binding Protein-Like 9 (OSBPL9))

Alternative Name: OSBPL9 (OSBPL9 Products)

Synonyms: OSBPL9 antibody, osbpl9 antibody, MGC145585 antibody, ORP-9 antibody, DKFZp469M1123 antibody, ORP9 antibody, zgc:154069 antibody, 2600011I06Rik antibody, AU015843 antibody, Orp-9 antibody, oxysterol binding protein-like 9 antibody, oxysterol binding protein like 9 antibody, oxysterol-binding protein-related protein 9 antibody, oxysterol binding protein like 9 L homeolog antibody, Osbpl9 antibody, OSBPL9 antibody, Tsp_05293 antibody, LOC578365 antibody, osbpl9 antibody, osbpl9.L antibody

Background: OSBPL9 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain.

Molecular Weight: 61 kDa (MW of target protein)