RDM1 antibody (Middle Region)

Catalog No. ABIN631469

Product Details anti-RDM1 Antibody

Target: RDM1 (RAD52 Motif 1 (RDM1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RDM1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RDM1 antibody was raised against the middle region of RDM1

Purification: Affinity purified

Immunogen: RDM1 antibody was raised using the middle region of RDM1 corresponding to a region with amino acids NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDM1 Blocking Peptide, catalog no. 33R-6889, is also available for use as a blocking control in assays to test for specificity of this RDM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RDM1

Target: RDM1 (RAD52 Motif 1 (RDM1))

Alternative Name: RDM1 (RDM1 Products)

Synonyms: RAD52B antibody, 2410008M22Rik antibody, AW212028 antibody, Rad52b antibody, RDM1 antibody, rad52b antibody, RAD52 motif containing 1 antibody, RAD52 motif 1 antibody, RDM1 antibody, Rdm1 antibody, rdm1 antibody

Background: RDM1 is a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. It contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization.

Molecular Weight: 26 kDa (MW of target protein)