LRRC6 antibody (Middle Region)
-
- Target See all LRRC6 Antibodies
- LRRC6 (Leucine Rich Repeat Containing 6 (LRRC6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRC6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRC6 antibody was raised against the middle region of LRRC6
- Purification
- Affinity purified
- Immunogen
- LRRC6 antibody was raised using the middle region of LRRC6 corresponding to a region with amino acids MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE
- Top Product
- Discover our top product LRRC6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRC6 Blocking Peptide, catalog no. 33R-6170, is also available for use as a blocking control in assays to test for specificity of this LRRC6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC6 (Leucine Rich Repeat Containing 6 (LRRC6))
- Alternative Name
- LRRC6 (LRRC6 Products)
- Synonyms
- LRTP antibody, Lrtp antibody, Tslrp antibody, CILD19 antibody, TSLRP antibody, lrrc6l antibody, leucine rich repeat containing 6 (testis) antibody, leucine rich repeat containing 6 antibody, Lrrc6 antibody, LRRC6 antibody, lrrc6 antibody
- Background
- LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.
- Molecular Weight
- 51 kDa (MW of target protein)
- Pathways
- M Phase
-