Hydroxyacid Oxidase 2 (HAO2) antibody
-
- Target See all Hydroxyacid Oxidase 2 (HAO2) Antibodies
- Hydroxyacid Oxidase 2 (HAO2)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HAO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW
- Top Product
- Discover our top product HAO2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HAO2 Blocking Peptide, catalog no. 33R-1885, is also available for use as a blocking control in assays to test for specificity of this HAO2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Hydroxyacid Oxidase 2 (HAO2)
- Alternative Name
- HAO2 (HAO2 Products)
- Synonyms
- GIG16 antibody, HAOX2 antibody, AI325478 antibody, Hao-2 antibody, Hao3 antibody, Haox3 antibody, zgc:63690 antibody, hao2 antibody, hydroxyacid oxidase 2 antibody, hydroxyacid oxidase 2 (long chain) antibody, hydroxyacid oxidase 2 (long chain) S homeolog antibody, HAO2 antibody, Hao2 antibody, hao2 antibody, hao2.S antibody
- Background
- HAO2 is one of three related proteins that have 2-hydroxyacid oxidase activity yet differ in amino acid sequence, tissue expression and substrate preference. Subcellular location of the protein is the peroxisome. Specifically, the protein is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-