Calicin antibody (C-Term)

Catalog No. ABIN631496

Product Details anti-Calicin Antibody

Target: Calicin (CCIN)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Calicin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Calicin antibody was raised against the C terminal of CCIN

Purification: Affinity purified

Immunogen: Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calicin Blocking Peptide, catalog no. 33R-9333, is also available for use as a blocking control in assays to test for specificity of this Calicin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Calicin

Target: Calicin (CCIN)

Alternative Name: Calicin (CCIN Products)

Synonyms: CCIN antibody, BTBD20 antibody, 4933417A14Rik antibody, calicin antibody, CCIN antibody, Ccin antibody

Background: CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.

Molecular Weight: 65 kDa (MW of target protein)