QTRT1 antibody

Catalog No. ABIN631538

Product Details anti-QTRT1 Antibody

Target: QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This QTRT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

QTRT1 Blocking Peptide, catalog no. 33R-3000, is also available for use as a blocking control in assays to test for specificity of this QTRT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for QTRT1

Target: QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))

Alternative Name: QTRT1 (QTRT1 Products)

Synonyms: CG4947 antibody, Dmel\\CG4947 antibody, TGT antibody, tgt antibody, zgc:66378 antibody, FP3235 antibody, TGUT antibody, 2610028E17Rik antibody, Tgt antibody, Tgut antibody, tRNA-guanine transglycosylase antibody, queuine tRNA-ribosyltransferase 1 S homeolog antibody, queuine tRNA-ribosyltransferase 1 antibody, queuine tRNA-ribosyltransferase catalytic subunit 1 antibody, Tgt antibody, Olsu_0732 antibody, Palpr_1298 antibody, Riean_1227 antibody, Calni_1240 antibody, Ftrac_0312 antibody, Ocepr_1541 antibody, Sulku_0977 antibody, Tmar_0854 antibody, Bache_2323 antibody, Nitsa_1291 antibody, Isop_1657 antibody, Despr_0021 antibody, Pedsa_1842 antibody, Corgl_1148 antibody, Mahau_0921 antibody, Theth_0831 antibody, qtrt1.S antibody, qtrt1 antibody, QTRT1 antibody, Qtrt1 antibody

Background: TRNA-guanine transglycosylase synthesizes queuosine (Q), which is found in tRNAs that recognise NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kDa. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60 kDa subunit and a 43 kDa catalytic subunit

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process