CHST14 antibody
-
- Target See all CHST14 Antibodies
- CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHST14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM
- Top Product
- Discover our top product CHST14 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHST14 Blocking Peptide, catalog no. 33R-7896, is also available for use as a blocking control in assays to test for specificity of this CHST14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST14 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 14 (CHST14))
- Alternative Name
- CHST14 (CHST14 Products)
- Synonyms
- ATCS antibody, D4ST1 antibody, HNK1ST antibody, 2600016L03Rik antibody, D4ST-1 antibody, D4st1 antibody, d4st1 antibody, MGC136487 antibody, wu:fc04a01 antibody, zgc:136487 antibody, carbohydrate sulfotransferase 14 antibody, carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 antibody, CHST14 antibody, Chst14 antibody, chst14 antibody
- Background
- CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-