GSTa5 antibody (Middle Region)
-
- Target See all GSTa5 Antibodies
- GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GSTa5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GSTA5 antibody was raised against the middle region of GSTA5
- Purification
- Affinity purified
- Immunogen
- GSTA5 antibody was raised using the middle region of GSTA5 corresponding to a region with amino acids QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE
- Top Product
- Discover our top product GSTa5 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GSTA5 Blocking Peptide, catalog no. 33R-7675, is also available for use as a blocking control in assays to test for specificity of this GSTA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))
- Alternative Name
- GSTA5 (GSTa5 Products)
- Background
- GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.
- Molecular Weight
- 26 kDa (MW of target protein)
-