GLO1 antibody (N-Term)

Catalog No. ABIN631567

Product Details anti-GLO1 Antibody

Target: GLO1 (Glyoxalase I (GLO1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLO1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLO1 antibody was raised against the N terminal of GLO1

Purification: Affinity purified

Immunogen: GLO1 antibody was raised using the N terminal of GLO1 corresponding to a region with amino acids TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLO1 Blocking Peptide, catalog no. 33R-9204, is also available for use as a blocking control in assays to test for specificity of this GLO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLO1

Target: GLO1 (Glyoxalase I (GLO1))

Alternative Name: GLO1 (GLO1 Products)

Synonyms: GLOD1 antibody, GLYI antibody, 0610009E22Rik antibody, 1110008E19Rik antibody, 2510049H23Rik antibody, AW550643 antibody, GLY1 antibody, Glo-1 antibody, Glo-1r antibody, Glo-1s antibody, Glo1-r antibody, Glo1-s antibody, Qglo antibody, cb554 antibody, zgc:66035 antibody, wu:fb82g09 antibody, glod1 antibody, glyi antibody, glo1 antibody, GLO1 antibody, ATGLX1 antibody, F12F1.32 antibody, F12F1_32 antibody, GLYOXALASE I antibody, glyoxalase I homolog antibody, trypanothione-dependent glyoxalase I antibody, glyoxalase I antibody, glyoxalase 1 antibody, glyoxalase 1 L homeolog antibody, glyoxalase 1 S homeolog antibody, lactoylglutathione lyase antibody, glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein antibody, GLO1 antibody, Glo1 antibody, glo1 antibody, glo1.L antibody, glo1.S antibody, GST3 antibody, GLX1 antibody, STY1687 antibody, Bcen_2094 antibody, gloA antibody

Background: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Molecular Weight: 21 kDa (MW of target protein)