PDLIM3 antibody (N-Term)

Catalog No. ABIN631568

Product Details anti-PDLIM3 Antibody

Target: PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDLIM3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDLIM3 antibody was raised against the N terminal of PDLIM3

Purification: Affinity purified

Immunogen: PDLIM3 antibody was raised using the N terminal of PDLIM3 corresponding to a region with amino acids PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDLIM3 Blocking Peptide, catalog no. 33R-7314, is also available for use as a blocking control in assays to test for specificity of this PDLIM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDLIM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDLIM3

Target: PDLIM3 (PDZ and LIM Domain 3 (PDLIM3))

Alternative Name: PDLIM3 (PDLIM3 Products)

Synonyms: LIM antibody, Actn2lp antibody, Alp antibody, AI463105 antibody, ALP antibody, alp antibody, hm:zeh1190 antibody, pdlim3 antibody, sb:eu571 antibody, zgc:110415 antibody, PDZ and LIM domain 3 antibody, PDZ and LIM domain 3 S homeolog antibody, PDZ and LIM domain 3b antibody, PDZ and LIM domain 3a antibody, PDLIM3 antibody, Pdlim3 antibody, pdlim3.S antibody, pdlim3b antibody, pdlim3a antibody

Background: PDLIM3 contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, PDLIM3 has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle.

Molecular Weight: 39 kDa (MW of target protein)