GMPPA antibody (N-Term)

Catalog No. ABIN631606

Product Details anti-GMPPA Antibody

Target: GMPPA (GDP-Mannose Pyrophosphorylase A (GMPPA))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GMPPA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GMPPA antibody was raised against the N terminal of GMPPA

Purification: Affinity purified

Immunogen: GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GMPPA Blocking Peptide, catalog no. 33R-5075, is also available for use as a blocking control in assays to test for specificity of this GMPPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GMPPA

Target: GMPPA (GDP-Mannose Pyrophosphorylase A (GMPPA))

Alternative Name: GMPPA (GMPPA Products)

Synonyms: gmppa antibody, zgc:66135 antibody, gmppaa antibody, gmppab antibody, Afu6g07620 antibody, 1810012N01Rik antibody, GMPP-alpha antibody, zgc:91853 antibody, GDP-mannose pyrophosphorylase A antibody, GDP-mannose pyrophosphorylase Ab antibody, GDP-mannose pyrophosphorylase A S homeolog antibody, GDP-mannose pyrophosphorylase A L homeolog antibody, GDP-mannose pyrophosphorylase Aa antibody, GMPPA antibody, gmppab antibody, gmppa.S antibody, gmppa.L antibody, AFUA_6G07620 antibody, NFIA_053290 antibody, ACLA_081780 antibody, PMAA_032270 antibody, AFLA_036250 antibody, TSTA_065350 antibody, BDBG_03451 antibody, Gmppa antibody, gmppaa antibody

Background: GMPPA is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.

Molecular Weight: 46 kDa (MW of target protein)