Keratin 75 antibody (Middle Region)

Catalog No. ABIN631612

Product Details anti-Keratin 75 Antibody

Target: Keratin 75 (KRT75)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Keratin 75 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cytokeratin 75 antibody was raised against the middle region of KRT75

Purification: Affinity purified

Immunogen: Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 75 Blocking Peptide, catalog no. 33R-8442, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 75 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Keratin 75

Target: Keratin 75 (KRT75)

Alternative Name: Cytokeratin 75 (KRT75 Products)

Synonyms: KRT75 antibody, K6HF antibody, KB18 antibody, PFB antibody, 4732468K03Rik antibody, AA589387 antibody, K6hf antibody, Krt2-6hf antibody, Krtcap1 antibody, Kb18 antibody, keratin 75 antibody, keratin, type II cytoskeletal 75 antibody, keratin, type II cytoskeletal 6A antibody, KRT75 antibody, LOC466991 antibody, LOC100566287 antibody, Krt75 antibody

Background: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells.

Molecular Weight: 59 kDa (MW of target protein)