HSPA4 antibody (N-Term)

Catalog No. ABIN631620

Product Details anti-HSPA4 Antibody

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPA4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HSPA4 antibody was raised against the N terminal of HSPA4

Purification: Affinity purified

Immunogen: HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA4 Blocking Peptide, catalog no. 33R-6956, is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPA4

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Alternative Name: HSPA4 (HSPA4 Products)

Synonyms: APG-2 antibody, HS24/P52 antibody, HSPH2 antibody, RY antibody, hsp70 antibody, hsp70RY antibody, Hsp110 antibody, Hsp70 antibody, irp94 antibody, 70kDa antibody, AI317151 antibody, Hsp70RY antibody, mKIAA4025 antibody, hspa4 antibody, wu:fi30e11 antibody, zgc:55743 antibody, zgc:77413 antibody, hs24/p52 antibody, hspa4-a antibody, osp94 antibody, pg-2 antibody, hspa4l antibody, wu:fc41d05 antibody, wu:fi59h02 antibody, wu:fj35c08 antibody, zgc:55506 antibody, heat shock protein family A (Hsp70) member 4 antibody, heat shock protein family A member 4 antibody, heat shock protein 4 antibody, heat shock protein 4b antibody, heat shock protein family A (Hsp70) member 4 S homeolog antibody, heat shock protein 4a antibody, HSPA4 antibody, Hspa4 antibody, hspa4b antibody, hspa4.S antibody, hspa4a antibody

Background: HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue.

Molecular Weight: 94 kDa (MW of target protein)