PNMA3 antibody (Middle Region)
-
- Target See all PNMA3 Antibodies
- PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PNMA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PNMA3 antibody was raised against the middle region of PNMA3
- Purification
- Affinity purified
- Immunogen
- PNMA3 antibody was raised using the middle region of PNMA3 corresponding to a region with amino acids RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR
- Top Product
- Discover our top product PNMA3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PNMA3 Blocking Peptide, catalog no. 33R-7985, is also available for use as a blocking control in assays to test for specificity of this PNMA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))
- Alternative Name
- PNMA3 (PNMA3 Products)
- Background
- This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.
- Molecular Weight
- 52 kDa (MW of target protein)
-