NKD1 antibody
-
- Target See all NKD1 Antibodies
- NKD1 (Naked Cuticle Homolog 1 (NKD1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NKD1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- NKD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG
- Top Product
- Discover our top product NKD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NKD1 Blocking Peptide, catalog no. 33R-2577, is also available for use as a blocking control in assays to test for specificity of this NKD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NKD1 (Naked Cuticle Homolog 1 (NKD1))
- Alternative Name
- NKD1 (NKD1 Products)
- Synonyms
- 2810434J10Rik antibody, 9030215G15Rik antibody, Nkd antibody, Naked1 antibody, naked cuticle homolog 1 antibody, naked cuticle 1 homolog (Drosophila) antibody, naked cuticle homolog 1 (Drosophila) antibody, NKD1 antibody, Nkd1 antibody, nkd1 antibody
- Background
- In the mouse, NkDa is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.
- Molecular Weight
- 52 kDa (MW of target protein)
-