GRK4 antibody (Middle Region)
-
- Target See all GRK4 Antibodies
- GRK4 (G Protein-Coupled Receptor Kinase 4 (GRK4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GRK4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GRK4 antibody was raised against the middle region of GRK4
- Purification
- Affinity purified
- Immunogen
- GRK4 antibody was raised using the middle region of GRK4 corresponding to a region with amino acids QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY
- Top Product
- Discover our top product GRK4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GRK4 Blocking Peptide, catalog no. 33R-7734, is also available for use as a blocking control in assays to test for specificity of this GRK4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRK4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRK4 (G Protein-Coupled Receptor Kinase 4 (GRK4))
- Alternative Name
- GRK4 (GRK4 Products)
- Synonyms
- GPRK2L antibody, GPRK4 antibody, GRK4a antibody, IT11 antibody, A830025H08Rik antibody, GRK antibody, Gprk2l antibody, Gprk4 antibody, AMPK antibody, AMPKalpha antibody, CG3051 antibody, DmAMPK alpha antibody, Dmel\\CG3051 antibody, EG:132E8.2 antibody, FBgn0023169 antibody, Gprk-4 antibody, ampk antibody, ampkalpha antibody, dAMPKa antibody, dAMPKalpha antibody, snf1a antibody, gprk4 antibody, gprk4-a antibody, grk4 antibody, GRK4 antibody, gprk4-b antibody, zgc:153020 antibody, gprk2l antibody, grk4a antibody, it11 antibody, G protein-coupled receptor kinase 4 antibody, AMP-activated protein kinase alpha subunit antibody, G protein-coupled receptor kinase 4 L homeolog antibody, G protein-coupled receptor kinase 4 S homeolog antibody, GRK4 antibody, Grk4 antibody, AMPKalpha antibody, grk4.L antibody, grk4.S antibody, grk4 antibody, LOC100540688 antibody
- Background
- GRK4 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. GRK4 has been linked to both genetic and acquired hypertension.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-