FBXO8 antibody (Middle Region)

Catalog No. ABIN631700

Product Details anti-FBXO8 Antibody

Target: FBXO8 (F-Box Protein 8 (FBXO8))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO8 antibody was raised against the middle region of FBXO8

Purification: Affinity purified

Immunogen: FBXO8 antibody was raised using the middle region of FBXO8 corresponding to a region with amino acids EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO8 Blocking Peptide, catalog no. 33R-2402, is also available for use as a blocking control in assays to test for specificity of this FBXO8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO8

Target: FBXO8 (F-Box Protein 8 (FBXO8))

Alternative Name: FBXO8 (FBXO8 Products)

Synonyms: FBXO8 antibody, T24I21.22 antibody, T24I21_22 antibody, zgc:136842 antibody, FBS antibody, FBX8 antibody, Fbx8 antibody, F-box protein 8 antibody, F-box and associated interaction domains-containing protein antibody, F-box protein 8 L homeolog antibody, FBXO8 antibody, fbxo8 antibody, AT2G16810 antibody, fbxo8.L antibody, Fbxo8 antibody

Background: FBXO8 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO8 belongs to the Fbxs class.

Molecular Weight: 37 kDa (MW of target protein)