GPD1L antibody (Middle Region)

Catalog No. ABIN631705

Product Details anti-GPD1L Antibody

Target: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPD1L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GPD1 L antibody was raised against the middle region of GPD1

Purification: Affinity purified

Immunogen: GPD1 L antibody was raised using the middle region of GPD1 corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPD1L Blocking Peptide, catalog no. 33R-2538, is also available for use as a blocking control in assays to test for specificity of this GPD1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPD1L

Target: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Alternative Name: GPD1L (GPD1L Products)

Synonyms: wu:fi13g03 antibody, wu:fi45b08 antibody, zgc:92580 antibody, GPD1-L antibody, 2210409H23Rik antibody, D9Ertd660e antibody, RGD1560123 antibody, glycerol-3-phosphate dehydrogenase 1 like antibody, glycerol-3-phosphate dehydrogenase 1-like antibody, glycerol-3-phosphate dehydrogenase 1 like L homeolog antibody, gpd1l antibody, GPD1L antibody, gpd1l.L antibody, Gpd1l antibody

Background: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Molecular Weight: 38 kDa (MW of target protein)