FBXO28 antibody (Middle Region)

Catalog No. ABIN631726

Product Details anti-FBXO28 Antibody

Target: FBXO28 (F-Box Protein 28 (FBXO28))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO28 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO28 antibody was raised against the middle region of FBXO28

Purification: Affinity purified

Immunogen: FBXO28 antibody was raised using the middle region of FBXO28 corresponding to a region with amino acids ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO28 Blocking Peptide, catalog no. 33R-2539, is also available for use as a blocking control in assays to test for specificity of this FBXO28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO28

Target: FBXO28 (F-Box Protein 28 (FBXO28))

Alternative Name: FBXO28 (FBXO28 Products)

Synonyms: fd49h06 antibody, wu:fd49h06 antibody, FBXO28 antibody, CENP-30 antibody, Fbx28 antibody, 4833428J17Rik antibody, 5730505P19Rik antibody, D1Ertd578e antibody, mKIAA0483 antibody, F-box protein 28 antibody, F-box protein 28 L homeolog antibody, fbxo28 antibody, fbxo28.L antibody, FBXO28 antibody, Fbxo28 antibody

Background: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 41 kDa (MW of target protein)